An Improved Search Algorithm for Optimal Multiple-Sequence Alignment

S. Schroedl

Volume 23, 2005

Links to Full Text:

Abstract:
Multiple sequence alignment (MSA) is a ubiquitous problem in computational biology. Although it is NP-hard to find an optimal solution for an arbitrary number of sequences, due to the importance of this problem researchers are trying to push the limits of exact algorithms further. Since MSA can be cast as a classical path finding problem, it is attracting a growing number of AI researchers interested in heuristic search algorithms as a challenge with actual practical relevance.

Extracted Text

 

Journal of Artificial Intelligence Research 23 (2005) 587-623 Submitted 7/04; published 5/05 An Improved Search Algorithm for Optimal Multiple-Sequence Alignment Stefan Schroedl stefan.schroedl@gmx.de 848 14th St San Francisco CA 94114 +1 (415) 522-1148 Abstract Multiple sequence alignment (MSA) is a ubiquitous problem in computational biology. Although it is NP -hard to find an optimal solution for an arbitrary number of sequences,due to the importance of this problem researchers are trying to push the limits of exactalgorithms further. Since MSA can be cast as a classical path finding problem, it is at-tracting a growing number of AI researchers interested in heuristic search algorithms as achallenge with actual practical relevance. In this paper, we first review two previous, complementary lines of research. Based on Hirschberg’s algorithm, Dynamic Programming needs O(kN k−1) space to store both thesearch frontier and the nodes needed to reconstruct the solution path, for k sequences oflength N . Best first search, on the other hand, has the advantage of bounding the searchspace that has to be explored using a heuristic. However, it is necessary to maintain allexplored nodes up to the final solution in order to prevent the search from re-expandingthem at higher cost. Earlier approaches to reduce the Closed list are either incompatiblewith pruning methods for the Open list, or must retain at least the boundary of the Closedlist. In this article, we present an algorithm that attempts at combining the respective advantages; like A∗ it uses a heuristic for pruning the search space, but reduces boththe maximum Open and Closed size to O(kN k−1), as in Dynamic Programming. Theunderlying idea is to conduct a series of searches with successively increasing upper bounds,but using the DP ordering as the key for the Open priority queue. With a suitable choiceof thresholds, in practice, a running time below four times that of A∗ can be expected. In our experiments we show that our algorithm outperforms one of the currently most successful algorithms for optimal multiple sequence alignments, Partial Expansion A∗, bothin time and memory. Moreover, we apply a refined heuristic based on optimal alignmentsnot only of pairs of sequences, but of larger subsets. This idea is not new; however, tomake it practically relevant we show that it is equally important to bound the heuristiccomputation appropriately, or the overhead can obliterate any possible gain. Furthermore, we discuss a number of improvements in time and space efficiency with regard to practical implementations. Our algorithm, used in conjunction with higher-dimensional heuristics, is able to cal- culate for the first time the optimal alignment for almost all of the problems in Reference 1of the benchmark database BAliBASE . 1. Introduction: Multiple Sequence Alignment The multiple sequence alignment problem (MSA) in computational biology consists in align-ing several sequences, e.g. related genes from different organisms, in order to reveal simi- c 2005 AI Access Foundation. All rights reserved.

Schroedl larities and differences across the group. Either DNA can be directly compared, and theunderlying alphabet Σ consists of the set C,G,A,T for the four standard nucleotide basescytosine, guanine, adenine and thymine; or we can compare proteins, in which case Σcomprises the twenty amino acids. Roughly speaking, we try to write the sequences one above the other such that the columns with matching letters are maximized; thereby gaps (denoted here by an additionalletter “ ”) may be inserted into either of them in order to shift the remaining characters intobetter corresponding positions. Different letters in the same column can be interpreted asbeing caused by point mutations during the course of evolution that substituted one aminoacid by another one; gaps can be seen as insertions or deletions (since the direction ofchange is often not known, they are also collectively referred to as indels). Presumably, thealignment with the fewest mismatches or indels constitutes the biologically most plausibleexplanation. There is a host of applications of MSA within computational biology; e.g., for deter- mining the evolutionary relationship between species, for detecting functionally active siteswhich tend to be preserved best across homologous sequences, and for predicting three-dimensional protein structure. Formally, one associates a cost with an alignment and tries to find the (mathematically) optimal alignment, i.e., that one with minimum cost. When designing a cost function,computational efficiency and biological meaning have to be taken into account. The mostwidely-used definition is the sum-of-pairs cost function. First, we are given a symmetric(|Σ| + 1)2 matrix containing penalties (scores) for substituting a letter with another one(or a gap). In the simplest case, this could be one for a mismatch and zero for a match,but more biologically relevant scores have been developed. Dayhoff, Schwartz, and Orcutt(1978) have proposed a model of molecular evolution where they estimate the exchangeprobabilities of amino acids for different amounts of evolutionary divergence; this gives riseto the so-called PAM matrices, where PAM250 is generally the most widely used; Jones,Taylor, and Thornton (1992) refined the statistics based on a larger body of experimentaldata. Based on such a substitution matrix, the sum-of-pairs cost of an alignment is definedas the sum of penalties between all letter pairs in corresponding column positions. A pairwise alignment can be conveniently depicted as a path between two opposite corners in a two-dimensional grid (Needleman and Wunsch, 1981): one sequence is placedon the horizontal axis from left to right, the other one on the vertical axis from top tobottom. If there is no gap in either string, the path moves diagonally down and right; a gapin the vertical (horizontal) string is represented as a horizontal (vertical) move right (down),since a letter is consumed in only one of the strings. The alignment graph is directed andacyclic, where a (non-border) vertex has incoming edges from the left, top, and top-leftadjacent vertices, and outgoing edges to the right, bottom, and bottom-right vertices. Pairwise alignment can be readily generalized to the simultaneous alignment of multiple sequences, by considering higher-dimensional lattices. For example, an alignment of threesequences can be visualized as a path in a cube. Fig. 1 illustrates an example for the stringsABCB, BCD, and DB. It also shows the computation of the sum-of-pairs cost, for a hypotheticalsubstitution matrix. A real example (problem 2trx of BAliBASE , see Sec. 7.3) is given inFig. 2. 588

An Improved Search Algorithm for Optimal Multiple-Sequence Alignment Alignment: Substitution matrix: A B C &95; B A B C D &95; &95; B C D &95; A 0 2 4 2 3 &95; &95; &95; D B B 1 3 3 3 C 2 2 3 Cost: 6+7+8+7+7 = 35 D 1 3 &95; 0 end D C B B D B C B A start Figure 1: Fictitious alignment problem: Column representation, cost matrix, three- dimensional visualization of the alignment path through the cube. A number of improvements can be integrated into the sum-of-pairs cost, like associating weights with sequences, and using different substitution matrices for sequences of varyingevolutionary distance. A major issue in multiple sequence alignment algorithms is theirability to handle gaps. Gap penalties can be made dependent on the neighbor letters.Moreover, it has been found (Altschul, 1989) that assigning a fixed score for each indelsometimes does not produce the biologically most plausible alignment. Since the insertionof a sequence of x letters is more likely than x separate insertions of a single letter, gap costfunctions have been introduced that depend on the length of a gap. A useful approximationare affine gap costs, which distinguish between opening and extension of a gap and chargea + b ∗ x for a gap of length x, for appropriate a and b. Another frequently used modificationis to waive the penalties for gaps at the beginning or end of a sequence. Technically, in order to deal with affine gap costs we can no longer identify nodes in the search graph with lattice vertices, since the cost associated with an edge depends on thepreceding edge in the path. Therefore, it is more suitable to store lattice edges in the priority 589

Schroedl 1thx &95;aeqpvlvyfwaswcgpcqlmsplinlaantysdrlkvvkleidpnpttvkkyk&95;&95;&95;&95;&95;&95;vegvpal 1grx &95;&95;mqtvi&95;&95;fgrsgcpysvrakdlaeklsnerdd&95;fqyqyvdiraegitkedlqqkagkpvetvp&95;&95; 1erv agdklvvvdfsatwcgpckmikpffhslsekysn&95;viflevdvddcqdvasece&95;&95;&95;&95;&95;&95;vksmptf 2trcP &95;kvttivvniyedgvrgcdalnssleclaaeypm&95;vkfckira&95;sntgagdrfs&95;&95;&95;&95;&95;&95;sdvlptl 1thx rlvkgeqildstegvis&95;&95;kdkllsf&95;ldthln&95;&95;&95;&95;&95;&95;&95;&95;&95; 1grx qifvdqqhiggytdfaawvken&95;&95;&95;&95;&95;lda&95;&95;&95;&95;&95;&95;&95;&95;&95;&95;&95;&95; 1erv qffkkgqkvgefsgan&95;&95;&95;kek&95;&95;&95;&95;&95;leatine&95;&95;lv&95;&95;&95;&95; 2trcP lvykggelisnfisvaeqfaedffaadvesflneygllper&95; Figure 2: Alignment of problem 2trx of BAliBASE , computed with algorithm settings as described in Sec. 7.3. A B C D A g = 53 cost(&95;,C)=3 B gap penalty = 4g = 60 A cost(A,&95;)=3 cost(A,C)=4 gap penalty = 4 gap penalty = 0g = 57 g = 60 D Figure 3: Example of computing path costs with affine gap function; the substitution matrix of Fig. 1 and a gap opening penalty of 4 is used. queue, and let the transition costs for u → v, v → w be the sum-of-pairs substitution costsfor using one character from each sequence or a gap, plus the incurred gap penalties forv → w followed by u → v. This representation was adopted in the program MSA (Gupta,Kececioglu, & Schaeffer, 1995). Note that the state space in this representation grows bya factor of 2k. An example of how successor costs are calculated, with the cost matrix ofFig. 1 and a gap opening penalty of 4, is shown in Fig. 3. For convenience of terminology in the sequel we will still refer to nodes when dealing with the search algorithm. 590

An Improved Search Algorithm for Optimal Multiple-Sequence Alignment 2. Overview Wang and Jiang (1994) have shown that the optimal multiple sequence alignment problem isNP -hard; therefore, we cannot hope to achieve an efficient algorithm for an arbitrary numberof sequences. As a consequence, alignment tools most widely used in practice sacrifice thesound theoretical basis of exact algorithms, and are heuristic in nature (Chan, Wong, &Chiu, 1992). A wide variety of techniques has been developed. Progressive methods buildup the alignment gradually, starting with the closest sequences and successively addingmore distant ones. Iterative strategies refine an initial alignment through a sequence ofimprovement steps. Despite their limitation to moderate number of sequences, however, the research into exact algorithms is still going on, trying to push the practical boundaries further. They stillform the building block of heuristic techniques, and incorporating them into existing toolscould improve them. For example, an algorithm iteratively aligning two groups of sequencesat a time could do this with three or more, to better avoid local minima. Moreover, it istheoretically important to have the “gold standard” available for evaluation and comparison,even if not for all problems. Since MSA can be cast as a minimum-cost path finding problem, it turns out that it is amenable to heuristic search algorithms developed in the AI community; these are actuallyamong the currently best approaches. Therefore, while many researchers in this area haveoften used puzzles and games in the past to study heuristic search algorithms, recently therehas been a rising interest in MSA as a testbed with practical relevance, e.g., (Korf, 1999;Korf & Zhang, 2000; Yoshizumi, Miura, & Ishida, 2000; Zhou & Hansen, 2003b); its studyhas also led to major improvements of general search techniques. It should be pointed out that the definition of the MSA problem as given above is not the only one; it competes with other attempts at formalizing biological meaning, which is oftenimprecise or depends on the type of question the biologist investigator is pursuing. E.g., inthis paper we are only concerned with global alignment methods, which find an alignment ofentire sequences. Local methods, in contrast, are geared towards finding maximally similarpartial sequences, possibly ignoring the remainder. In the next section, we briefly review previous approaches, based on dynamic program- ming and incorporating lower and upper bounds. In Sec. 4, we describe a new algorithmthat combines and extends some of these ideas, and allows to reduce the storage of Closednodes by partially recomputing the solution path at the end (Sec. 5). Moreover, it turns outthat our algorithm’s iterative deepening strategy can be transferred to find a good balancebetween the computation of improved heuristics and the main search (Sec. 6), an issue thathas previously been a major obstacle for their practical application. Sec. 7 presents anexperimental comparison with Partial Expansion A∗ (Yoshizumi, Miura, & Ishida, 2000),one of the currently most successful approaches. We also solve all but two problems ofReference 1 of the widely used benchmark database BAliBASE (Thompson, Plewniak, &Poch, 1999). To the best of our knowledge, this has not been achieved previously with anexact algorithm. 591

Schroedl 3. Previous Work A number of exact algorithms have been developed previously that can compute alignmentsof a moderate number of sequences. Some of them are mostly constrained by availablememory, some by the required computation time, and some on both. We can roughlygroup them into two categories: those based on the dynamic programming paradigm, whichproceed primarily in breadth-first fashion; and best-first search, utilizing lower and upperbounds to prune the search space. Some recent research, including our new algorithmintroduced in Sec. 4, attempts to beneficially combine these approaches. 3.1 Dijkstra’s Algorithm and Dynamic Programming Dijkstra (1959) presented a general algorithm for finding the shortest (resp. minimum cost)path in a directed graph. It uses a priority queue (heap) to store nodes v together withthe shortest found distance from the start node s (i.e., the top-left corner of the grid) to v(also called the g-value of v). Starting with only s in the priority queue, in each step, anedge with the minimum g-value is removed from the priority queue; its expansion consistsin generating all of its successors (vertices to the right and/or below) reachable in one step,computing their respective g-value by adding the edge cost to the previous g-value, andinserting them in turn into the priority queue in case this newly found distance is smallerthan their previous g-value. By the time a node is expanded, the g-value is guaranteed tobe the minimal path cost from the start node, g∗(v) = d(s, v). The procedure runs until thepriority queue becomes empty, or the target node t (the bottom-right corner of the grid)has been reached; its g-value then constitutes the optimal solution cost g∗(t) = d(s, t) ofthe alignment problem. In order to trace back the path corresponding to this cost, we movebackwards to the start node choosing predecessors with minimum cost. The nodes can eitherbe stored in a fixed matrix structure corresponding to the grid, or they can be dynamicallygenerated; in the latter case, we can explicitly store at each node a backtrack-pointer tothis optimal parent. For integer edge costs, the priority queue can be implemented as a bucket array pointing to doubly linked lists (Dial, 1969), so that all operations can be performed in constant time(To be precise, the DeleteMin-operation also needs a pointer that runs through all differentg-values once; however, we can neglect this in comparison to the number of expansions).To expand a vertex, at most 2k − 1 successor vertices have to be generated, since we havethe choice of introducing a gap in each sequence. Thus, Dijkstra’s algorithm can solve themultiple sequence alignment problem in O(2kN k) time and O(N k) space for k sequences oflength ≤ N . A means to reduce the number of nodes that have to be stored for path reconstruction is by associating a counter with each node that maintains the number of children whosebacktrack-pointer refers to them (Gupta et al., 1995). Since each node can be expanded atmost once, after this the number of referring backtrack-pointers can only decrease, namely,whenever a cheaper path to one of its children is found. If a node’s reference count goesto zero, whether immediately after its expansion or when it later loses a child, it canbe deleted for good. This way, we only keep nodes in memory that have at least onedescendant currently in the priority queue. Moreover, auxiliary data structures for vertices 592

An Improved Search Algorithm for Optimal Multiple-Sequence Alignment and coordinates are most efficiently stored in tries (prefix trees); they can be equipped withreference counters as well and be freed accordingly when no longer used by any edge. The same complexity as for Dijkstra’s algorithm holds for dynamic programming (DP); it differs from the former one in that it scans the nodes in a fixed order that is knownbeforehand (hence, contrary to the name the exploration scheme is actually static). Theexact order of the scan can vary (e.g., row-wise or column-wise), as long as it is compatiblewith the topological ordering of the graph (e.g., for two sequences that the cells left, top,and diagonally top-left have been explored prior to a cell). One particular such ordering isthat of antidiagonals, diagonals running from upper-right to lower-left. The calculation ofthe antidiagonal of a node merely amounts to summing up its k coordinates. Hirschberg (1975) noticed that in order to determine only the cost of the optimal align- ment g∗(t), it would not be necessary to store the whole matrix; instead, when proceedinge.g. by rows it suffices to keep track of only k of them at a time, deleting each row as soonas the next one is completed. This reduces the space requirement by one dimension fromO(N k) to O(kN k−1). In order to recover the solution path at the end, re-computation ofthe lost cell values is needed. A Divide-and-conquer -strategy applies the algorithm twiceto half the grid each, once in forward and once in backward direction, meeting at a fixedmiddle row. By adding the corresponding forward and backward distances in this middlerow and finding the minimum, one cell lying on an optimal path can be recovered. Thiscell essentially splits the problem into two smaller subproblems, one from the upper leftcorner to it, and the other one to the lower right corner; they can be recursively solvedusing the same method. In two dimensions, the computation time is at most doubled, andthe overhead reduces even more in higher dimensions. The FastLSA algorithm (Davidson, 2001) further refines Hirschberg’s algorithm by ex- ploiting additionally available memory to store more than one node on an optimal path,thereby reducing the number of re-computations. 3.2 Algorithms Utilizing Bounds While Dijkstra’s algorithm and dynamic programming can be viewed as variants of breadth-first search, we achieve best first search if we expand nodes v in the order of an estimate(lower bound) of the total cost of a path from s to the t passing through v. Rather than usingthe g-value as in Dijkstra’s algorithm, we use f (v) := g(v) + h(v) as the heap key, whereh(v) is a lower bound on the cost of an optimal path from v to t. If h is indeed admissible,then the first solution found is guaranteed to be optimal (Hart, Nilsson, & Raphael, 1968).This is the classical best-first search algorithm, the A∗ algorithm, well known in the artificialintelligence community. In this context, the priority queue maintaining the generated nodesis often also called the Open list, while the nodes that have already been expanded andremoved from it constitute the Closed list. Fig. 4 schematically depicts a snapshot during atwo-dimensional alignment problem, where all nodes with f -value no larger than the currentfmin have been expanded. Since the accuracy of the heuristic decreases with the distance tothe goal, the typical ‘onion-shaped’ distribution results, with the bulk being located closerto the start node, and tapering out towards higher levels. The A∗ algorithm can significantly reduce the total number of expanded and generated nodes; therefore, in higher dimensions it is clearly superior to dynamic programming. How- 593

Schroedl Maximum Diameter Closed Open X Possible back leak Levels (antidiagonals) Start X X X X X X X X X X X End Figure 4: Snapshot during best-first search in pairwise alignment (schematically). ever, in contrast to the Hirschberg algorithm, it still stores all of the explored nodes in theClosed list. Apart from keeping track of the solution path, this is necessary to prevent thesearch from “leaking back”, in the following sense. A heuristic h is called consistent if h(x) ≤ h(x )+c(x, x ), for any node x and its child x . A consistent heuristic ensures that (as in the case of Dijkstra’s algorithm) at the time a nodeis expanded, its g-value is optimal, and hence it is never expanded again. However, if we tryto delete the Closed nodes, then there can be topologically smaller nodes in Open with ahigher f -value; when those are expanded at a later stage, they can lead to the re-generationof the node at a non-optimal g-value, since the first instantiation is no longer available forduplicate checking. In Fig. 4, nodes that might be subject to spurious re-expansion aremarked “X”. Researchers have tried to avoid these leaks, while retaining the basic A∗ search scheme. Korf proposed to store a list of forbidden operators with each node, or to place the parentsof a deleted node on Open with f -value infinity (Korf, 1999; Korf & Zhang, 2000). However,as Zhou and Hansen (2003a) remark, it is hard to combine this algorithm with techniquesfor reduction of the Open list, and moreover the storage of operators lets the size of thenodes grow exponentially with the number of sequences. In their algorithm, they keeptrack of the kernel of the Closed list, which is defined as the set of nodes that have onlyClosed nodes as parents; otherwise a Closed node is said to be in the boundary. The keyidea is that only the boundary nodes have to be maintained, since they shield the kernelfrom re-expansions. Only when the algorithm gets close to the memory limit nodes fromthe kernel are deleted; the backtrack pointer of the children is changed to the parents of 594

An Improved Search Algorithm for Optimal Multiple-Sequence Alignment the deleted nodes, which become relay nodes for them. For the final reconstruction of theoptimal solution path, the algorithm is called recursively for each relay node to bridge thegap of missing edges. In addition to the Closed list, also the Open list can grow rapidly in sequence alignment problems. Particularly, since in the original A∗ algorithm the expansion of a node generatesall of its children at once, those whose f -value is larger than the optimal cost g∗(t) are keptin the heap up to the end, and waste much of the available space. If an upper bound U on the optimal solution cost g∗(t) is known, then nodes v with f (v) > U can be pruned right away; this idea is used in several articles (Spouge, 1989; Guptaet al., 1995). One of the most successful approaches is Yoshizumi et al.’s (2000) PartialExpansion A∗ (PEA∗). Each node stores an additional value F , which is the minimumf -value of all of its yet ungenerated children. In each step, only a node with minimumF -value is expanded, and only those children with f = F are generated. This algorithmclearly only generates nodes with f value no larger than the optimal cost, which cannotbe avoided altogether. However, the overhead in computation time is considerable: in thestraightforward implementation, if we want to maintain nodes of constant size, generatingone edge requires determining the f -values of all successors, such that for an interior nodewhich eventually will be fully expanded the computation time is of the order of the squareof the number of successors, which grows as O(2k) with the number of sequences k. As aremedy, in the paper it is proposed to relax the condition by generating all children withf ≤ F + C, for some small C. An alternative general search strategy to A∗ that uses only linear space is iterative deepening A∗(IDA∗) (Korf, 1985). The basic algorithm conducts a depth-first search up toa pre-determined threshold for the f -value. During the search, it keeps track of the smallestf -value of a generated successor that is larger than the threshold. If no solution is found,this provides an increased threshold to be used in the next search iteration. Wah and Shang (1995) suggested more liberal schemes for determining the next thresh- old dynamically in order to minimize the number of recomputations. IDA∗ is most efficientin tree structured search spaces. However, it is difficult to detect duplicate expansions with-out additional memory; Therefore, unfortunately it is not applicable in lattice-structuredgraphs like in the sequence alignment problem due to the combinatorially explosive numberof paths between any two given nodes. A different line of research tries to restrict the search space of the breadth-first ap- proaches by incorporating bounds. Ukkonen (1985) presented an algorithm for the pairwisealignment problem which is particularly efficient for similar sequences; its computation timescales as O(dm), where d is the optimal solution cost. First consider the problem of decidingwhether a solution exists whose cost is less than some upper threshold U . We can restrictthe evaluation of the DP matrix to a band of diagonals where the minimum number ofindels required to reach the diagonal, times the minimum indel cost, does not exceed U .In general, starting with a minimum U value, we can successively double G until the testreturns a solution; the increase of computation time due to the recomputations is then alsobounded by a factor of 2. Another approach for multiple sequence alignment is to make use of the lower bounds h from A∗. The key idea is the following: Since all nodes with an f -value lower than g∗(t) haveto be expanded anyway in order to guarantee optimality, we might as well explore them in 595

Schroedl any reasonable order, like that of Dijkstra’s algorithm or DP, if we only knew the optimalcost. Even slightly higher upper bounds will still help pruning. Spouge (1989) proposed tobound DP to vertices v where g(v) + h(v) is smaller than an upper bound for g∗(t). Linear Bounded Diagonal Alignment (LBD-Align) (Davidson, 2001) uses an upper bound in order to reduce the computation time and memory in solving a pairwise alignmentproblem by dynamic programming. The algorithm calculates the DP matrix one antidi-agonal at a time, starting in the top left corner, and working down towards bottom-right.While A∗ would have to check the bound in every expansion, LBD-Align only checks thetop and bottom cell of each diagonal. If e.g. the top cell of a diagonal has been pruned, allthe remaining cells in that row can be pruned as well, since they are only reachable throughit; this means that the pruning frontier on the next row can be shifted down by one. Thus,the pruning overhead can be reduced from a quadratic to a linear amount in terms of thesequence length. 3.3 Obtaining Heuristic Bounds Up to now we have assumed lower and upper bounds, without specifying how to derive them.Obtaining an inaccurate upper bound on g∗(t) is fairly easy, since we can use the cost of anyvalid path through the lattice. Better estimates are e.g. available from heuristic linear-timealignment programs such as FASTA and BLAST (Altschul, Gish, Miller, Myers, & Lipman,1990), which are a standard method for database searches. Davidson (2001) employed alocal beam search scheme. Gusfield (1993) proposed an approximation called the star-alignment. Out of all the sequences to be aligned, one consensus sequence is chosen such that the sum of its pairwisealignment costs to the rest of the sequences is minimal. Using this “best” sequence asthe center, the other ones are aligned using the “once a gap, always a gap” rule. Gusfieldshowed that the cost of the optimal alignment is greater or equal to the cost of this staralignment, divided by (2 − 2/k). For use in heuristic estimates, lower bounds on the k-alignment are often based on optimal alignments of subsets of m < k sequences. In general, for a vertex v in k-space, weare looking for a lower bound for a path from v to the target corner t. Consider first thecase m = 2. The cost of such a path is, by definition, the sum of its edge costs, where eachedge cost in turn is the sum of all pairwise (replacement or gap) penalties. Each multiplesequence alignment induces a pairwise alignment for sequences i and j, by simply copyingrows i and j and ignoring columns with a “ ” in both rows. These pairwise alignments canbe visualized as the projection of an alignment onto its faces, cf. Fig. 1. By interchange of the summation order, the sum-of-pairs cost is the sum of all pairwise alignment costs of the respective paths projected on a face, each of which cannot be smallerthan the optimal pairwise path cost. Thus, we can construct an admissible heuristic hpairby computing, for each pairwise alignment and for each cell in a pairwise problem, thecheapest path cost to the goal node. The optimal solutions to all pairwise alignment problems needed for the lower bound h values are usually computed prior to the main search in a preprocessing step (Ikeda & Imai,1994). To this end, it suffices to apply the ordinary DP procedure; however, since this timewe are interested in the lowest cost of a path from v to t, it runs in backward direction, 596

An Improved Search Algorithm for Optimal Multiple-Sequence Alignment proceeding from the lower right corner to the upper left, expanding all possible parents ofa vertex in each step. Let U be an upper bound on the cost of an optimal multiple sequence alignment G. The sum of all optimal alignment costs Lij = d(sij, tij) for pairwise subproblems i, j ∈1, . . . , k, i < j, call it L, is a lower bound on G. Carrillo and Lipman (1988) pointed outthat by the additivity of the sum-of-pairs cost function, any pairwise alignment inducedby the optimal multiple sequence alignment can at most be δ = U − L larger than therespective optimal pairwise alignment. This bound can be used to restrict the number ofvalues that have to be computed in the preprocessing stage and have to be stored for thecalculation of the heuristic: for the pair of sequences i, j, only those nodes v are feasiblesuch that a path from the start node si,j to the goal node ti,j exists with total cost no morethan Li,j + δ. To optimize the storage requirements, we can combine the results of twosearches. First, a forward pass determines for each relevant node v the minimum distanced(sij, v) from the start node. The subsequent backward pass uses this distance like an ’exactheuristic’ and stores the distance d(v, tij) from the target node only for those nodes withd(sij, v) + d(v, tij) ≤ d(s, t) + δ1. Still, for larger alignment problems the required storage size can be extensive. The program MSA (Gupta et al., 1995) allows the user to adjust δ to values below the Carrillo-Lipman bound individually for each pair of sequences. This makes it possible to generateat least heuristic alignments if time or memory doesn’t allow for the complete solution;moreover, it can be recorded during the search if the δ-bound was actually reached. In thenegative case, optimality of the found solution is still guaranteed; otherwise, the user cantry to run the program again with slightly increased bounds. The general idea of precomputing simplified problems and storing the solutions for use as a heuristic has been explored under the name of pattern databases (Culberson & Schaeffer,1998). However, these approaches implicitly assume that the computational cost can beamortized over many search instances to the same target. In contrast, in the case of MSA,the heuristics are instance-specific, so that we have to strike a balance. We will discuss thisin greater depth in Sec. 6.2. 4. Iterative-Deepening Dynamic Programming As we have seen, a fixed search order as in dynamic programming can have several advan-tages over pure best-first selection. • Since Closed nodes can never be reached more than once during the search, it is safe to delete useless ones (those that are not part of any shortest path to the current Open 1. A slight technical complication arises for affine gap costs: recall that DP implementations usually charge the gap opening penalty to the g-value of the edge e starting the gap, while the edge e ending the gapcarries no extra penalty at all. However, since the sum of pairs heuristics h is computed in backwarddirection, using the same algorithm we would assign the penalty for the same path instead to e . Thismeans that the heuristic f = g + h would no longer be guaranteed to be a lower bound, since itcontains the penalty twice. As a remedy, it is necessary to make the computation symmetric by chargingboth the beginning and end of a gap with half the cost each. The case of the beginning and end ofthe sequences can be handled most conveniently by starting the search from a “dummy” diagonal edge((−1, . . . , −1), (0, . . . , 0)), and defining the target edge to be the dummy diagonal edge ((N, . . . , N ), (N +1, . . . , N + 1)), similar to the arrows shown in Fig. 1. 597

Schroedl nodes) and to apply path compression schemes, such as the Hirschberg algorithm.No sophisticated schemes for avoiding ’back leaks’ are required, such as the above-mentioned methods of core set maintenance and dummy node insertion into Open. • Besides the size of the Closed list, the memory requirement of the Open list is de- termined by the maximum number of nodes that are open simultaneously at anytime while the algorithm is running. When the f -value is used as the key for thepriority queue, the Open list usually contains all nodes with f -values in some range(fmin, fmin + δ); this set of nodes is generally spread across all over the search space,since g (and accordingly h = (f − g)) can vary arbitrarily between 0 and fmin + δ. Asopposed to that, if DP proceeds along levels of antidiagonals or rows, at any iterationat most k levels have to be maintained at the same time, and hence the size of theOpen list can be controlled more effectively. In Fig. 4, the pairwise alignment is par-titioned into antidiagonals: the maximum number of open nodes in any two adjacentlevels is four, while the total amounts to seventeen2. • For practical purposes, the running time should not only be measured in terms of the number of node expansions, but one should also take into account the execution timeneeded for an expansion. By arranging the exploration order such that edges withthe same head node (or more generally, those sharing a common coordinate prefix)are dealt with one after the other, much of the computation can be cached, and edgegeneration can be sped up significantly. We will come back to this point in Sec. 6. The remaining issue of a static exploration scheme consists in adequately bounding the search space using the h-values. A∗ is known to be minimal in terms of the number of nodeexpansions. If we knew the cost g∗(t) of a cheapest solution path beforehand, we couldsimply proceed level by level of the grid, however only immediately prune generated edgese whenever f (e) > g∗(t). This would ensure that we only generate those edges that wouldhave been generated by algorithm A∗, as well. An upper threshold would additionally helpreduce the size of the Closed list, since a node can be pruned if all of its children lie beyondthe threshold; additionally, if this node is the only child of its parent, this can give rise toa propagating chain of ancestor deletions. We propose to apply a search scheme that carries out a series of searches with succes- sively larger thresholds, until a solution is found (or we run out of memory or patience).The use of such an upper bound parallels that in the IDA∗ algorithm. The resulting algorithm, which we will refer to as Iterative-Deepening Dynamic Pro- gramming (IDDP), is sketched in Fig. 5. The outer loop initializes the threshold with alower bound (e.g., h(s)), and, unless a solution is found, increases it up to an upper bound.In the same manner as in the IDA∗ algorithm, in order to make sure that at least one addi-tional edge is explored in each iteration the threshold has to be increased correspondinglyat least to the minimum cost of a fringe edge that exceeded the previous threshold. Thisfringe increment is maintained in the variable minNextThresh, initially estimated as theupper bound, and repeatedly decreased in the course of the following expansions. 2. Contrary to what the figure might suggest, A∗ can open more than two nodes per level in pairwise alignments, if the set of nodes no worse than some fmin contains “holes”. 598

An Improved Search Algorithm for Optimal Multiple-Sequence Alignment procedure IDDP(Edge startEdge, Edge targetEdge, int lowerBound, int upperBound)int thresh = lowerBoundOuter loop: Iterative deepening phaseswhile (thresh ≤ upperBound) do Heap h = (startEdge, 0)int minNextThresh = upperBoundInner loop: Bounded dynamic programmingwhile (not h.IsEmpty()) do Edge e = h.DeleteMin() Find and remove an edge with minimum levelif (e == targetEdge) then Optimal alignment foundreturn TraceBackPath(startEdge, targetEdge) end ifExpand(e, thresh, minNextThresh) end whileint threshIncr = ComputeThreshIncr() Compute search threshold for next iteration, see textthresh = max(thresh + threshIncr, minNextThresh) end whileprint(“No alignment with cost at most upperBound found”) Figure 5: Algorithm Iterative-Deepening Dynamic Programming. In each step of the inner loop, we select and remove a node from the priority queue whose level is minimal. As explained later in Sec. 6, it is favorable to break ties accordingto the lexicographic order of target nodes. Since the total number of possible levels iscomparatively small and known in advance, the priority queue can be implemented usingan array of linked lists (Dial, 1969); this provides constant time operations for insertion anddeletion. The expansion of an edge e is partial (Fig. 6). A child edge might already exist from an earlier expansion of an edge with the same head vertex; we have to test if we can decreasethe g-value. Otherwise, we generate a new edge, if only temporarily for the sake of calculat-ing its f -value; that is, if its f -value exceeds the search threshold of the current iteration,its memory is immediately reclaimed. Moreover, in this case the fringe threshold minNext-Thresh is updated. In a practical implementation, we can prune unnecessary accesses topartial alignments inside the calculation of the heuristic e.GetH() as soon as as the searchthreshold has already been reached. The relaxation of a child edge within the threshold is performed by the subprocedure UpdateEdge (cf. Fig. 7). This is similar to the corresponding relaxation step in A∗, updatingthe child’s g- and f values, its parent pointers, and inserting it into Open, if not alreadycontained. However, in contrast to best-first search, it is inserted into the heap according tothe antidiagonal level of its head vertex. Note that in the event that the former parent losesits last child, propagation of deletions (Fig. 8) can ensure that only those Closed nodescontinue to be stored that belong to some solution path. Edge deletions can also ensuedeletion of dependent vertex and coordinate data structures (not shown in the pseudocode).The other situation that gives rise to deletions is if immediately after the expansion of anode no children are pointing back to it (the children might either be reachable more cheaplyfrom different nodes, or their f -value might exceed the threshold). 599

Schroedl procedure Expand(Edge e, int thresh, int minNextThresh)for all Edge child ∈ Succ(e) do Retrieve child or tentatively generate it if not yet existing, set boolean variable ‘created’accordinglyint newG = e.GetG() + GapCost(e, child) + child.GetCost() int newF = newG + child.GetH()if (newF ≤ thresh and newG < child.GetG()) then Shorter path than current best found, estimate within thresholdchild.SetG(newG)UpdateEdge(e, child, h) Update search structures else if (newF > thresh) then minNextThresh = min(minNextThresh, newF) Record minimum of pruned edgesif (created) then Delete(child) Make sure only promising edges are stored end if end if end forif (e.ref == 0) then DeleteRec(e) No promising children could be inserted into the heap end if Figure 6: Edge expansion in IDDP. procedure UpdateEdge(Edge parent, Edge child, Heap h)parent.ref++child.GetBacktrack().ref−−if (child.GetBacktrack().ref == 0) then DeleteRec(child.GetBacktrack()) The former parent has lost its last child and becomes useless end ifchild.SetBacktrack(parent)if (not h.Contains(child)) then h.Insert(child, child.GetHead().GetLevel()) end if Figure 7: Edge relaxation in IDDP. The correctness of the algorithm can be shown analogously to the soundness proof of A∗. If the threshold is smaller than g∗(t), the DP search will terminate without encounteringa solution; otherwise, only nodes are pruned that cannot be part of an optimal path. Theinvariant holds that there is always a node in each level which lies on an optimal path andis in the Open list. Therefore, if the algorithm terminates only when the heap runs empty,the best found solution will indeed be optimal. The iterative deepening strategy results in an overhead computation time due to re- expansions, and we are trying to restrict this overhead as much as possible. More precisely, 600

An Improved Search Algorithm for Optimal Multiple-Sequence Alignment procedure DeleteRec(Edge e)if (e.GetBacktrack() = nil) then e.GetBacktrack().ref−−if (e.GetBacktrack().ref == 0) then DeleteRec(e.GetBacktrack()) end if end ifDelete(e) Figure 8: Recursive deletion of edges that are no longer part of any solution path. procedure TraceBack(Edge startEdge, Edge e)if (e == startEdge) then return End of recursion end ifif (e.GetBackTrack().GetTarget() = e.GetSource()) then Relay node: recursive path reconstructionIDDP( e.GetBackTrack(), e, e.GetF(), e.GetF()) end ifOutputEdge(e)TraceBack(startEdge, e.GetBackTrack()) Figure 9: Divide-and-Conquer solution reconstruction in reverse order. we want to minimize the ratio nIDDP ν = , nA∗ where nIDDP and nA∗ denote the number of expansions in IDDP and A∗, respectively. Oneway to do so (Wah & Shang, 1995) is to choose a threshold sequence θ1, θ2, . . . such thatthe number of expansions ni in stage i satisfies ni = rni−1, for some fixed ratio r. If we choose r too small, the number of re-expansions and hencethe computation time will grow rapidly, if we choose it too big, then the threshold of thelast iteration can exceed the optimal solution cost significantly, and we will explore manyirrelevant edges. Suppose that n0rp < nA∗ ≤ n0rp+1. Then the algorithm performs p + 1iterations. In the worst case, the overshoot will be maximal if A∗ finds the optimal solutionjust above the previous threshold, nA∗ = n0rp + 1. The total number of expansions isn p+1 r(rp+1−1) 0 ri = n , and the ratio ν becomes approximately r2 . By setting the i=0 0 r−1 r−1 derivative of this expression to zero, we find that the optimal value for r is 2; the numberof expansions should double from one search stage to the next. If we achieve doubling, wewill expand at most four times as many nodes as A∗. Like in Wah and Shang’s (1995) scheme, we dynamically adjust the threshold using run- time information. Procedure ComputeThreshIncr stores the sequence of expansion numbersand thresholds from the previous search stages, and then uses curve fitting for extrapolation(in the first few iterations without sufficient data available, a very small default thresholdis applied). We found that the distribution of nodes n(θ) with f -value smaller or equal to 601

Schroedl threshold θ can be modeled very accurately according to the exponential approach n(θ) = A · Bθ. Consequently, in order to attempt to double the number of expansions, we choose the nextthreshold according to 1 θi+1 = θi + . log2 B 5. Sparse Representation of Solution Paths When the search progresses along antidiagonals, we do not have to fear back leaks, andare free to prune Closed nodes. Similarly as in Zhou and Hansen’s (2003a) work, however,we only want to delete them lazily and incrementally when being forced by the algorithmapproaching the computer’s memory limit. When deleting an edge e, the backtrack-pointers of its child edges that refer to it are redirected to the respective predecessor of e, whose reference count is increased accordingly.In the resulting sparse solution path representation, backtrack pointers can point to anyoptimal ancestors. After termination of the main search, we trace back the pointers starting with the goal edge; this is outlined in Procedure TraceBack (Fig. 9), which prints out the solution pathin reverse order. Whenever an edge e points back to an ancestor e which is not its directparent, we apply an auxiliary search from start edge e to goal edge e in order to reconstructthe missing links of the optimal solution path. The search threshold can now be fixed at theknown solution cost; moreover, the auxiliary search can prune those edges that cannot beancestors of e because they have some coordinate greater than the corresponding coordinatein e. Since also the shortest distance between e and e is known, we can stop at the first paththat is found at this cost. To improve the efficiency of the auxiliary search even further,the heuristic could be recomputed to suit the new target. Therefore, the cost of restoringthe solution path is usually marginal compared to that of the main search. Which edges are we going to prune, in which order? For simplicity, assume for the moment that the Closed list consists of a single solution path. According to the Hirschbergapproach, we would keep only one edge, preferably lying near the center of the searchspace (e.g., on the longest anti-diagonal), in order to minimize the complexity of the twoauxiliary searches. With additional available space allowing to store three relay edges, wewould divide the search space into four subspaces of about equal size (e.g., additionallystoring the antidiagonals half-way between the middle antidiagonal and the start node resp.the target node). By extension, in order to incrementally save space under diminishingresources we would first keep only every other level, then every fourth, and so on, until onlythe start edge, the target edge, and one edge half-way on the path would be left. Since in general the Closed list contains multiple solution paths (more precisely, a tree of solution paths), we would like to have about the same density of relay edges on each ofthem. For the case of k sequences, an edge reaching level l with its head node can originatewith its tail node from level l − 1, . . . , l − k. Thus, not every solution path passes througheach level, and deleting every other level could result in leaving one path completely intact,while extinguishing another totally. Thus, it is better to consider contiguous bands of k 602

An Improved Search Algorithm for Optimal Multiple-Sequence Alignment procedure SparsifyClosed()for (int sparse = 1 to log N ) do 2 while (UsedMemory() > maxMemory and exists Edge e ∈ Open | e.GetLastSparse() <sparse) do Edge pred = e.GetBacktrack()Trace back solution pathwhile (pred = nil and e.GetLastSparse() < sparse) do e.SetLastSparse(sparse) Mark to avoid repeated trace-backif ( pred.GetHead().GetLevel() / k mod 2sparse = 0) then pred lies in prunable band: redirect pointere.SetBacktrack(pred.GetBacktrack())e.GetBacktrack().ref++pred.ref−−if (pred.ref == 0) then e is the last remaining edge referring to predDeleteRec(pred) end if else Not in prunable band: continue traversale = e.GetBacktrack() end ifpred = e.GetBacktrack() end while end while end for Figure 10: Sparsification of Closed list under restricted memory. levels each, instead of individual levels. Bands of this size cannot be skipped by any path.The total number of antidiagonals in an alignment problem of k sequences of length N isk · N − 1; thus, we can decrease the density in log2 N steps. A technical implementation issue concerns the ability to enumerate all edges that ref- erence some given prunable edge, without explicitly storing them in a list. However, thereference counting method described above ensures that any Closed edge can be reached byfollowing a path bottom-up from some edge in Open. The procedure is sketched in Fig. 10.The variable sparse denotes the interval between level bands that are to be maintained inmemory. In the inner loop, all paths to Open nodes are traversed in backward direction;for each edge e that falls into a prunable band, the pointer of the successor e on the pathis redirected to its respective backtrack pointer. If e was the last edge referencing e , thelatter one is deleted, and the path traversal continues up to the start edge. When all Opennodes have been visited and the memory bound is still exceeded, the outer loop tries todouble the number of prunable bands by increasing sparse. Procedure SparsifyClosed is called regularly during the search, e.g., after each expansion. However, a naive version as described above would incur a huge overhead in computationtime, particularly when the algorithm’s memory consumption is close to the limit. There-fore, some optimizations are necessary. First, we avoid tracing back the same solution pathat the same (or lower) sparse interval by recording for each edge the interval when it was 603

Schroedl traversed the last time (initially zero); only for an increased variable sparse there can beanything left for further pruning. In the worst case, each edge will be inspected log2 Ntimes. Secondly, it would be very inefficient to actually inspect each Open node in the innerloop, just to find that its solution path has been traversed previously, at the same or highersparse value; however, with an appropriate bookkeeping strategy it is possible to reduce thetime for this search overhead to O(k). 6. Use of Improved Heuristics As we have seen, the estimator hpair, the sum of optimal pairwise goal distances, givesa lower bound on the actual path length. However, more powerful heuristics are also conceivable. While their computation will require more resources, the trade-off can proveitself worthwhile; the tighter the estimator is, the smaller is the space that the main searchneeds to explore. 6.1 Beyond Pairwise Alignments Kobayashi and Imai (1998) suggested to generalize hpair by considering optimal solutionsfor subproblems of size m > 2. They proved that the following heuristics are admissibleand more informed than the pairwise estimate. • hall,m is the sum of all m-dimensional optimal costs, divided by k−2 . m−2 • hone,m splits the sequences into two sets of sizes m and k − m; the heuristic is the sum of the optimal cost of the first subset, plus that of the second one, plus the sum of all2-dimensional optimal costs of all pairs of sequences in different subsets. Usually, mis chosen close to k/2. These improved heuristics can reduce the main search effort by orders of magnitudes. However, in contrast to pairwise sub-alignments, time and space resources devoted to com-pute and store higher-dimensional heuristics are in general no longer negligible comparedto the main search. Kobayashi and Imai (1998) noticed that even for the case m = 3 oftriples of sequences, it can be impractical to compute the entire subheuristic hall,m. As onereduction, they show that it suffices to restrict oneself to nodes where the path cost doesnot exceed the optimal path cost of the subproblem by more than k − 2 δ = U − d(si , ti ); m − 2 1,...,im 1,...,im i1,...,im this threshold can be seen as a generalization of the Carrillo-Lipman bound. However, it can still incur excessive overhead in space and computation time for the computation ofthe k lower-dimensional subproblems. A drawback is that it requires an upper bound m U , on whose accuracy also the algorithm’s efficiency hinges. We could improve this boundby applying more sophisticated heuristic methods, but it seems counterintuitive to spendmore time doing so which we would rather use to calculate the exact solution. In spite ofits advantages for the main search, the expensiveness of the heuristic calculation appearsas a major obstacle. 604

An Improved Search Algorithm for Optimal Multiple-Sequence Alignment McNaughton, Lu, Schaeffer, and Szafron (2002) suggested to partition the heuristic into (hyper-) cubes using a hierarchical oct-tree data structure; in contrast to “full” cells,“empty” cells only retain the values at their surface. When the main search tries to use oneof them, its interior values are recomputed on demand. Still, this work assumes that eachnode in the entire heuristic is calculated at least once using dynamic programming. We see one cause of the dilemma in the implicit assumption that a complete computation is necessary. The bound δ above refers to the worst-case, and can generally include manymore nodes than actually required in the main search. However, since we are only dealingwith the heuristic, we can actually afford to miss some values occasionally; while this mightslow down the main search, it cannot compromise the optimality of the final solution.Therefore, we propose to generate the heuristics with a much smaller bound δ. Wheneverthe attempt to retrieve a value of the m-dimensional subheuristic fails during the mainsearch, we simply revert to replacing it by the sum of the m optimal pairwise goal distances 2 it covers. We believe that the IDDP algorithm lends itself well to make productive use of higher- dimensional heuristics. Firstly and most importantly, the strategy of searching to adaptivelyincreasing thresholds can be transferred to the δ-bound as well; this will be addressed inmore detail in the next section. Secondly, as far as a practical implementation is concerned, it is important to take into account not only how a higher-dimensional heuristic affects the number of node expansions,but also their time complexity. This time is dominated by the number of accesses to sub-alignments. With k sequences, in the worst case an edge has 2k − 1 successors, leading toa total of k (2k − 1) m evaluations for hall,m. One possible improvement is to enumerate all edges emerging from agiven vertex in lexicographic order, and to store partial sums of heuristics of prefix subsetsof sequences for later re-use. In this way, if we allow for a cache of linear size, the numberof accesses is reduced to i=k i − 1 2i ; m − 1 i=m correspondingly, for a quadratic cache we only need i=k i − 2 2i m − 2 i=m evaluations. For instance, in aligning 12 sequences using hall,3, a linear cache reduces theevaluations to about 37 percent within one expansion. As mentioned above, in contrast to A∗, IDDP gives us the freedom to choose any particular expansion order of the edges within a given level. Therefore, when we sort edgeslexicographically according to the target nodes, much of the cached prefix information canbe shared additionally across consecutively expanded edges. The higher the dimension ofthe subalignments, the larger are the savings. In our experiments, we experienced speedupsof up to eighty percent in the heuristic evaluation. 605

Schroedl 100 Main search Heuristic Total time 10   Execution time [s] 1 0.1 0 10 20 30 40 50 60 70 80 90 100 Heuristic miss ratio r [%] Figure 11: Trade-off between heuristic and main search: Execution times for problem 1tvxA as a function of heuristic miss ratio. 6.2 Trade-Off between Computation of Heuristic and Main Search As we have seen, we can control the size of the precomputed sub-alignments by choosingthe bound δ up to which f -values of edges are generated beyond the respective optimalsolution cost. There is obviously a trade-off between the auxiliary and main searches. Itis instructive to consider the heuristic miss ratio r, i.e., the fraction of calculations ofthe heuristic h during the main search when a requested entry in a partial MSA has notbeen precomputed. The optimum for the main search is achieved if the heuristic has beencomputed for every requested edge (r = 0). Going beyond that point will generate anunnecessarily large heuristic containing many entries that will never be actually used. Onthe other hand, we are free to allocate less effort to the heuristic, resulting in r > 0 andconsequently decreasing performance of the main search. Generally, the dependence hasan S-shaped form, as exemplified in Fig. 11 for the case of problem 1tvxA of BAliBASE(cf. next section). Here, the execution time of one iteration of the main search at a fixedthreshold of 45 above the lower bound is shown, which includes the optimal solution. Fig. 11 illustrates the overall time trade-off between auxiliary and main search, if we fix δ at different levels. The minimum total execution time, which is the sum of auxiliary andmain search, is attained at about r = 0.15 (5.86 seconds). The plot for the correspondingmemory usage trade-off has a very similar shape. Unfortunately, in general we do not know in advance the right amount of auxiliary search. As mentioned above, choosing δ according to the Carrillo-Lipman bound will ensure that 606

An Improved Search Algorithm for Optimal Multiple-Sequence Alignment 100 10   Execution time [s] 1 0.1 0 10 20 30 40 50 60 70 80 90 100 Heuristic miss ratio r [%] Figure 12: Time of the last iteration in the main search for problem 1tvxA as a function of heuristic miss ratio. every requested sub-alignment cost will have been precomputed; however, in general we willconsiderably overestimate the necessary size of the heuristic. As a remedy, our algorithm IDDP gives us the opportunity to recompute the heuristic in each threshold iteration in the main search. In this way, we can adaptively strike a balancebetween the two. When the currently experienced miss rate r rises above some threshold, we can suspend the current search, recompute the pairwise alignments with an increased threshold δ, andresume the main search with the improved heuristics. Like for the main search, we can accurately predict the auxiliary computation time and space at threshold δ using exponential fitting. Due to the lower dimensionality, itwill generally increase less steeply; however, the constant factor might be higher for theheuristic, due to the combinatorial number of k alignment problems to be solved. m A doubling scheme as explained above can bound the overhead to within a constant factor of the effort in the last iteration. In this way, when also limiting the heuristic computation time by a fixed fraction of the main search, we can ensure as an expectedupper bound that the overall execution time stays within a constant factor of the searchtime that would be required using only the pairwise heuristic. If we knew the exact relation between δ, r, and the speedup of the main search, an ideal strategy would double the heuristic whenever the expected computation time is smaller thanthe time saved in the main search. However, as illustrated in Fig. 12, this dependence ismore complex than simple exponential growth, it varies with the search depth and specificsof the problem. Either we would need a more elaborate model of the search space, or the 607

Schroedl algorithm would have to conduct exploratory searches in order to estimate the relation.We leave this issue to future work, and restrict ourselves here to a simplified, conservativeheuristic: We hypothesize that the main search can be made twice as fast by a heuristicdoubling if the miss rate r rises above 25 percent; in our experiments, we found that thisassumption is almost always true. In this event, since the effective branching factor of themain search is reduced by the improved heuristic, we also ignore the history of main searchtimes in the exponential extrapolation procedure for subsequent iterations. 7. Experimental Results In the following, we compare IDDP to one of the currently most successful approaches,Partial Expansion A∗. We empirically explore the benefit of higher-dimensional heuristics;finally, we show its feasibility by means of the benchmark database BAliBASE . 7.1 Comparison to Partial Expansion A∗ For the first series of evaluations, we ran IDDP on the same set of sequences as chosen byYoshizumi et al. (2000) (elongation factors EF-TU and EF-1α from various species, with ahigh degree of similarity). As in this work, substitution costs were chosen according to thePAM-250 matrix. The applied heuristic was the sum of optimal pairwise goal distances. Theexpansion numbers do not completely match with their results, however, since we appliedthe biologically more realistic affine gap costs: gaps of length x were charged 8 + 8 · x, exceptat the beginning and end of a sequence, where the penalty was 8 · x. All of the following experiments were run under RedHat Linux 7.3 on an Intel XeonT M CPU with 3.06 GHz, and main memory of 2 Gigabytes; we used the gcc 2.96 compiler. The total space consumption of a search algorithm is determined by the peak number of Open and Closed edges over the entire running time. Table 1 and Fig. 13 give these valuesfor the series of successively larger sets of input sequences (with the sequences numbered asdefined in Yoshizumi et al., 2000) 1 − 4, 1 − 5, . . ., 1 − 12. With our implementation, the basic A∗ algorithm could be carried out only up to 9 sequences, before exhausting our computer’s main memory. Confirming the results of Yoshizumi et al. (2000), Partial Expansion requires only about one percent of this space. Interestingly, during the iteration with the peak in total numbersof nodes held in memory, no nodes are actually closed except in problem 6. This mightbe explained with the high degree of similarity between sequences in this example. Recallthat PEA∗ only closes a node if all of its successors have an f -value of no more than theoptimal solution cost; if the span to the lower bound is small, each node can have at leastone “bad” successor that exceeds this difference. IDDP reduces the memory requirements further by a factor of about 6. The diagram also shows the maximum size of the Open list alone. For few sequences, the differencebetween the two is dominated by the linear length to store the solution path. As theproblem size increases, however, the proportion of the Closed list of the total memory dropsto about only 12 percent for 12 sequences. The total number of expansions (including allsearch stages) is slightly higher than in PEA∗; however, due to optimizations made possibleby the control of the expansion order, the execution time at 12 sequences is reduced byabout a third. 608

An Improved Search Algorithm for Optimal Multiple-Sequence Alignment Num Time Max Max Exp [sec] Open Open + Closed A∗ 4 626 0.01 7805 8432 5 1599 0.05 32178 33778 6 3267 0.25 124541 127809 7 10781 1.94 666098 676880 8 116261 49.32 9314734 9430996 9 246955 318.58 35869671 36116627 PEA∗ 3 448 0.01 442 442 4 716 0.01 626 626 5 2610 0.05 1598 1598 6 6304 0.33 3328 3331 7 23270 2.63 10874 10874 8 330946 87.24 118277 118277 9 780399 457.98 249279 249279 10 5453418 7203.17 1569815 1569815 11 20887627 62173.78 5620926 5620926 12 36078736 237640.14 9265949 9265949 IDDP 3 496 0.01 4 434 4 1367 0.02 9 443 5 6776 0.14 171 501 6 12770 0.59 414 972 7 26026 2.46 889 1749 8 362779 73.62 13620 19512 9 570898 250.48 21506 30009 10 4419297 4101.96 160240 192395 11 21774869 43708.14 860880 997163 12 36202456 158987.80 1417151 1616480 Table 1: Algorithm comparison for varying number of input sequences (elongation factors EF-TU and EF-1α). Since PEA∗ does not prune edges, its maximum space usage is always the total number of edges with f -value smaller than g∗(t) (call these edges the relevant edges, since they haveto be inspected by each admissible algorithm). In IDDP, on the other hand, the Open listcan only comprise k adjacent levels out of those edges (not counting the possible thresholdovershoot, which would contribute a factor of at most 2). Thus, the improvement of IDDPover PEA∗ will tend to increase with the overall number of levels (which is the sum of 609

Schroedl 1e+08 1e+07 1e+06 100000 10000 1000 Edges in memory 100 A* max open+closed 10 PEA* max open+closedIDDP max open+closedIDDP max open 1 3 4 5 6 7 8 9 10 11 12 Number of sequences Figure 13: Memory requirements for A∗, IDDP, and PEA∗(elongation factors EF-TU and EF-1α). all string lengths), divided by the number of sequences; in other words, with the averagesequence length. Moreover, the ratio depends on how well the heuristic suits the particular problem. Fig. 14 shows the distribution of all edges with f value smaller or equal to g∗(t), for thecase of 9 of the example sequences. This problem is quite extreme as the bulk of these edgesis concentrated in a small level band between 1050 and 1150. As an example with a moreeven distribution, Fig. 15 depicts the situation for problem 1cpt from Reference 1 in thebenchmark set BAliBASE (Thompson et al., 1999) with heuristic hall,3. In this case, theproportion of the overall 19492675 relevant edges that are maximal among all 4 adjacentlevels amounts to only 0.2 percent. The maximum Open size in IDDP is 7196, while thetotal number of edges generated by PEA∗ is 327259, an improvement by about a factor of45. 7.2 Multidimensional Heuristics On the same set of sequences, we compared different improved heuristics in order to get animpression for their respective potential. Specifically, we ran IDDP with heuristics hpair,hall,3, hall,4, and hone,k/2 at various thresholds δ. Fig. 16 shows the total execution timefor computing the heuristics, and performing the main search. In each case, we manuallyselected a value for δ which minimized this time. It can be seen that the times for hone,k/2lie only a little bit below hpair; For few sequences (less than six), the computation of theheuristics hall,3 and hall,4 dominates their overall time. With increasing dimensions, how- 610

An Improved Search Algorithm for Optimal Multiple-Sequence Alignment 0.016 0.014 0.012 0.01   0.008 0.006 0.004 Open edges / sum open edges [%] 0.002 0 0 500 1000 1500 2000 2500 3000 3500 4000 Level Figure 14: Distribution of relevant edges over levels (elongation factors EF-TU and EF-1α); compare to the schematic projection in Fig. 4. ever, this investment starts to yield growing returns, with hall,3 being the fastest algorithm,requiring only 5 percent of the time of hpair at 12 sequences. As far as memory is concerned, Fig. 17 reveals that the maximum size of the Open and Closed list, for the chosen δ values, is very similar for hpair and hone,k/2 on the one hand,and hall,3 and hall,4 on the other hand. At 12 sequences, hone,6 saves only about 60 percent of edges, while hall,3 only needs 2.6 percent and hall,4 only 0.4 percent of the space required by the pairwise heuristic. UsingIDDP, we never ran out of main memory; even larger test sets could be aligned, the rangeof the shown diagrams was limited by our patience to wait for the results for more than twodays. Based on the experienced burden of computing the heuristic, Kobayashi and Imai (1998) concluded that hone,m should be preferred to hall,m. We do not quite agree with this judg-ment. We see that the heuristic hall,m is able to reduce the search space of the main searchconsiderably stronger than hone,m, so that it can be more beneficial with an appropriateamount of heuristic computation. 7.3 The Benchmark Database BAliBASE BAliBASE (Thompson et al., 1999) is a widely used database of manually-refined multiplesequence alignments specifically designed for the evaluation and comparison of multiple se-quence alignment programs. The alignments are classified into 8 reference sets. Reference 1contains alignments of up to six about equidistant sequences. All the sequences are of sim- 611

Schroedl 0.00012 0.0001 8e-05   6e-05 4e-05 Open edges / sum open edges [%] 2e-05 0 0 200 400 600 800 1000 1200 1400 1600 Level Figure 15: Distribution of relevant edges over levels, problem 1cpt from BAliBASE . ilar length; they are grouped into 9 classes, indexed by sequence length and the percentageof identical amino acids in the same columns. Note that many of these problems are in-deed much harder than the elongation factor examples from the previous section; despiteconsisting of fewer sequences, their dissimilarities are much more pronounced. We applied our algorithm to Reference 1, with substitution costs according to the PET91 matrix (Jones et al., 1992) and affine gap costs of 9·x+8, except for leading and trailing gaps,where no gap opening penalty was charged. For all instances, we precomputed the pairwisesub-alignments up to a fixed bound of 300 above the optimal solution; the optimal solutionwas found within this bound in all cases, and the effort is generally marginal compared tothe overall computation. For all problems involving more than three sequences, the heuristichall,3 was applied. Out of the 82 alignment problems in Reference 1, our algorithm could solve all but 2 problems (namely, 1pamA and gal4 ) on our computer. Detailed results are listed in Tables 2through 10. Thompson, Plewniak, and Poch (1999) compared a number of widely used heuristic alignment tools using the so-called SP -score; their software calculates the percentage ofcorrectly aligned pairs within the biologically significant motifs. They found that all pro-grams perform about equally well for the sequences with medium and high amino acididentity; differences only occurred for the case of the more distant sequences with lessthan 25 percent identity, the so-called “twilight zone”. Particularly challenging was thegroup of short sequences. In this subgroup, the three highest scoring programs are PRRP,CLUSTALX, and SAGA, with respective median scores of 0.560, 0.687, and 0.529. Themedium score for the alignments found in our experiments amounts to 0.558; hence, it isabout as good as PRRP, and only beaten by CLUSTALX. While we focused in our exper- 612

An Improved Search Algorithm for Optimal Multiple-Sequence Alignment 1e+06 100000 10000 1000 100   10 Total time [sec] 1 0.1 2-fold heuristic 0.01 div-conq heuristic3-fold heuristic4-fold heuristic 0.001 2 4 6 8 10 12 14 Number of sequences Figure 16: Comparison of execution times (including calculation of heuristics), elongation factors EF-TU and EF-1α. iments on algorithmic feasibility rather than on solution quality, it would be worthwhileto attempt to improve the alignments found by these program using their more refinedpenalty functions. CLUSTALX, for example, uses different PAM matrices depending onthe evolutionary distance of sequences; moreover, it assigns weights to sequences (based ona phylogenetic tree), and gap penalties are made position-specific. All of these improve-ments can be easily integrated into the basic sum-of-pairs cost function, so that we couldattempt to compute an optimal alignment with respect to these metrics. We leave this lineof research for future work. Fig. 18 shows the maximum number of edges that have to be stored in Open during the search, in dependence of the search threshold in the final iteration. For better comparability,we only included those problems in the diagram that consist of 5 sequences. The logarithmicscale emphasizes that the growth fits an exponential curve quite well. Roughly speaking, anincrease of the cost threshold by 50 leads to a ten-fold increase in the space requirements.This relation is similarly applicable to the number of expansions (Fig. 19). Fig. 20 depicts the proportion between the maximum Open list size and the combined maximum size of Open and Closed. It is clearly visible that due to the pruning of edgesoutside of possible solution paths, the Closed list contributes less and less to the overallspace requirements the more difficult the problems become. Finally, we estimate the reduction in the size of the Open list compared to all relevant edges by the ratio of the maximum Open size in the last iteration of IDDP to the totalnumber of expansions in this stage, which is equal to the number of edges with f -valueless or equal to the threshold. Considering possible overshoot of IDDP, algorithm PEA∗ 613

Schroedl 1e+07 1e+06 100000   10000 Maximum size of open + closed 1000 2-fold heuristicdiv-conq heuristic3-fold heuristic4-fold heuristic 100 2 4 6 8 10 12 14 Number of sequences Figure 17: Combined maximum size of Open and Closed, for different heuristics (elongation factors EF-TU and EF-1α). 1e+07 1e+06 100000 10000 Max open 1000 100 10 ShortMedium lengthLong 1 0 50 100 150 200 250 300 Threshold - Lower bound Figure 18: Maximum size of Open list, dependent on the final search threshold (BAliBASE ). 614

An Improved Search Algorithm for Optimal Multiple-Sequence Alignment 1e+08 1e+07 1e+06 100000   10000 Expansions 1000 100 ShortMedium lengthLong 10 0 50 100 150 200 250 300 Threshold - Lower bound Figure 19: Number of expansions in the final search iteration (BAliBASE ). 80 70 60 50   40 30 20 Max open/ Max open + closed [%] 10 ShortMedium lengthLong 0 0 50 100 150 200 250 300 Threshold - Lower bound Figure 20: Maximum number of Open edges, divided by combined maximum of Open and Closed (BAliBASE ). 615

Schroedl 5 ShortMedium lengthLong 4 3   2 Max Open / Expansions [%] 1 0 0 50 100 150 200 250 300 Threshold - Lower bound Figure 21: Percentage of reduction in Open size (BAliBASE ). would expand at least half of these nodes. The proportion ranges between 0.5 to 5 percent(cf. Fig. 21). Its considerable scatter indicates the dependence on individual problem prop-erties; however, a slight average decrease can be noticed for the more difficult problems. 616

An Improved Search Algorithm for Optimal Multiple-Sequence Alignment 8. Conclusion and Discussion We have presented a new search algorithm for optimal multiple sequence alignment thatcombines the effective use of a heuristic bound as in best-first search with the ability of thedynamic programming approach to reduce the maximum size of the Open and Closed listsby up to one order of magnitude of the sequence length. The algorithm performs a seriesof searches with successively increasing bounds that explore the search space in DP order;the thresholds are chosen adaptively so that the expected overhead in recomputations isbounded by a constant factor. We have demonstrated that the algorithm can outperform one of the currently most successful algorithms for optimal multiple sequence alignments, Partial Expansion A∗, bothin terms of computation time and memory consumption. Moreover, the iterative-deepeningstrategy alleviates the use of partially computed higher-dimensional heuristics. To the bestof our knowledge, the algorithm is the first one that is able to solve standard benchmarkalignment problems in BAliBASE with a biologically realistic cost function including affinegap costs without end gap penalties. The quality of the alignment is in the range of thebest heuristic programs; while we have concentrated on algorithmic feasibility, we deem itworthwhile to incorporate their refined cost metrics for better results; we will study thisquestion in future work. Recently, we learned about related approaches developed simultaneously and indepen- dently by Zhou and Hansen (2003b, 2004). SweepA∗ explores a search graph accordingto layers in a partial order, but still uses the f -value for selecting nodes within one layer.Breadth-First Heuristic Search implicitly defines the layers in a graph with uniform costsaccording to the breadth-first traversal. Both algorithms incorporate upper bounds on theoptimal solution cost for pruning; however, the idea of adaptive threshold determination tolimit re-expansion overhead to a constant factor is not described. Moreover, they do notconsider the flexible use of additional memory to minimize the divide-and-conquer solutionreconstruction phase. Although we described our algorithm entirely within the framework of the MSA problem, it is straightforward to transfer it to any domain in which the state space graph is directedand acyclic. Natural candidates include applications where such an ordering is imposed bytime or space coordinates, e.g., finding the most likely path in a Markov model. Two of the BAliBASE benchmark problems could still not be solved by our algorithm within the computer’s main memory limit. Future work will include the integration oftechniques exploiting secondary memory. We expect that the level-wise exploration schemeof our algorithm lends itself naturally to external search algorithms, another currently veryactive research topic in Artificial Intelligence and theoretical computer science. Acknowledgments The author would like to thank the reviewers of this article whose comments have helpedin significantly improving it. 617

Schroedl Appendix A Table 2: Results for BAliBASE Reference 1, group of short sequences with low amino acid identity. The columns denote: S — number of aligned sequences; δ — upperbound for precomputing optimal solutions for partial problems in last iteration ofmain search; g∗(t) — optimal solution cost; h(s) — lower bound for solution cost,using heuristics; Exp — total number of expansions in all iterations of the mainsearch; Op — peak number of edges in Open list over the course of the search;Op+Cl — peak combined number of edges in either Open or Closed list duringsearch; Heu — peak number of sub—alignment edge costs stored as heuristic;Time: total running time including auxiliary and main search, in seconds; Mem— peak total memory usage for face alignments, heuristic, and main search, inKB. S δ g∗(t) h(s) Exp Op Op+Cl Heu Time Mem 1aboA 5 57 9006 8898 3413786 104613 176126 1654547 331.029 15568 1idy 5 50 8165 8075 1732008 74865 121404 970933 167.867 10893 1r69 4 20 6215 6183 634844 19938 41719 88802 22.517 3568 1tvxA 4 44 5532 5488 1263849 24226 48633 476622 52.860 5278 1ubi 4 30 7395 7357 1614286 26315 54059 289599 62.133 5448 1wit 5 69 14287 14176 6231378 209061 351582 2442098 578.907 27273 2trx 4 20 7918 7899 63692 3502 5790 127490 4.572 1861 Table 3: Short sequences, medium similarity. S δ g∗(t) h(s) Exp Op Op+Cl Heu Time Mem 1aab 4 20 6002 5984 263 12 83 4404 0.572 691 1fjlA 6 20 13673 13625 900 106 155 19573 0.985 1589 1hfh 5 30 16556 16504 137914 4852 8465 70471 14.077 2882 1hpi 4 20 5858 5835 1560 83 164 5269 0.679 656 1csy 5 30 14077 14026 52718 3872 5613 56191 6.165 2252 1pfc 5 30 15341 15277 118543 6477 8905 55887 11.850 2478 1tgxA 4 20 4891 4856 18987 543 1080 5507 1.196 649 1ycc 4 20 8926 8903 54049 1118 2010 77156 3.780 1644 3cyr 4 48 8480 8431 583260 13422 25806 193690 22.592 3076 451c 5 49 11440 11333 1213162 38004 54115 583363 111.675 6529 618

An Improved Search Algorithm for Optimal Multiple-Sequence Alignment Table 4: Short sequences, high similarity. S δ g∗(t) h(s) Exp Op Op+Cl Heu Time Mem 1aho 5 20 8251 8187 30200 2255 3074 10971 3.175 1042 1csp 5 20 8434 8427 90 2 78 3528 0.569 784 1dox 4 20 7416 7405 782 50 186 8406 0.652 823 1fkj 5 20 13554 13515 2621 140 222 10925 0.945 1511 1fmb 4 20 7571 7568 172 4 108 1804 0.540 788 1krn 5 20 9752 9747 101 1 87 6244 0.623 1035 1plc 5 20 12177 12152 454 25 103 10641 0.728 1415 2fxb 5 20 6950 6950 88 2 71 1432 0.534 617 2mhr 5 20 14317 14306 256 4 121 7853 0.668 1558 9rnt 5 20 12382 12367 350 19 108 6100 0.695 1250 Table 5: Medium-length sequences, low similarity. S δ g∗(t) h(s) Exp Op Op+Cl Heu Time Mem 1bbt3 5 160 30598 30277 902725789 11134608 15739188 23821767 43860.175 927735 1sbp 5 200 42925 42512 2144000052 6839269 11882990 65341855 106907.000 735053 1havA 5 200 31600 31234 2488806444 10891271 16321376 58639851 132576.000 927735 1uky 4 94 18046 17915 179802791 659435 1281339 15233338 7006.560 106184 2hsdA 4 96 21707 21604 65580608 293357 668926 12497761 2646.880 67788 2pia 4 161 22755 22616 97669470 789446 1673807 25718770 4310.030 142318 3grs 4 126 20222 20061 107682032 640391 1396982 24104710 4267.880 130425 kinase 5 200 45985 45520 2446667393 13931051 19688961 32422084 125170.460 927734 Table 6: Medium-length sequences, medium similarity. S δ g∗(t) h(s) Exp Op Op+Cl Heu Time Mem 1ad2 4 20 16852 16843 379 16 221 27887 0.959 2186 1aym3 4 20 19007 18978 466536 4801 8914 83634 15.386 3163 1gdoA 4 58 20696 20613 10795040 57110 102615 1265777 363.549 12028 1ldg 4 20 25764 25736 446123 4981 9052 169038 16.115 4484 1mrj 4 20 20790 20751 252601 4067 7380 33942 8.694 2905 1pgtA 4 50 17442 17398 1870204 19200 32476 485947 73.066 5869 1pii 4 20 20837 20825 25256 584 1414 116670 3.089 3338 1ton 5 102 32564 32428 13571887 351174 526102 11549908 1373.180 58704 2cba 5 160 40196 39914 60545205 1037828 1595955 19186631 2904.651 140712 619

Schroedl Table 7: Medium-length sequences, high similarity. S δ g∗(t) h(s) Exp Op Op+Cl Heu Time Mem 1amk 5 20 31473 31453 447 7 259 13120 0.825 3366 1ar5A 4 20 15209 15186 3985 128 356 22220 1.066 1755 1ezm 5 20 37396 37381 613 4 324 15751 0.836 3900 1led 4 20 18795 18760 93220 2956 4951 39962 3.761 2564 1ppn 5 20 27203 27159 18517 489 864 20209 2.545 2991 1pysA 4 20 19242 19215 10810 190 801 14344 1.200 2224 1thm 4 20 21470 21460 361 2 293 8090 0.682 2469 1tis 5 20 35444 35395 31996 448 915 42716 4.409 4122 1zin 4 20 16562 16546 771 23 225 6619 0.654 1767 5ptp 5 20 29776 29735 6558 309 539 37883 1.767 3600 Table 8: Long sequences, low similarity. S δ g∗(t) h(s) Exp Op Op+Cl Heu Time Mem 1ajsA 4 160 38382 38173 318460012 1126697 2310632 27102589 9827.233 208951 1cpt 4 160 39745 39628 873548 5260 12954 10494564 223.926 32119 1lvl 4 160 43997 43775 537914936 1335670 2706940 37491416 16473.420 255123 1ped 3 50 15351 15207 2566052 7986 27718 0 20.035 4447 2myr 4 200 43414 43084 3740017645 7596730 45488908 118747184 136874.980 927735 4enl 3 50 16146 16011 5169296 9650 30991 0 41.716 5589 Table 9: Long sequences, medium similarity. S δ g∗(t) h(s) Exp Op Op+Cl Heu Time Mem 1ac5 4 92 37147 37020 169779871 732333 1513853 18464119 6815.760 124877 1adj 4 20 32815 32785 207072 3106 5145 96176 7.829 4595 1bgl 4 243 78366 78215 188429118 857008 1744149 101816849 8795.000 291618 1dlc 4 106 47430 47337 14993317 65288 126608 12801019 843.402 43158 1eft 4 56 31377 31301 9379999 42620 72502 1476154 334.475 13115 1fieA 4 86 53321 53241 6905957 46779 90937 6040375 348.134 26884 1gowA 4 166 38784 38632 45590739 275256 544800 31318364 2251.190 99537 1pkm 4 89 36356 36256 11197890 75144 140472 5962640 505.778 27244 1sesA 5 58 57670 57557 4755983 96014 136677 3585721 463.962 27452 2ack 5 250 76937 76466 994225856 8077412 12436928 75819994 32965.522 765715 arp 5 143 54939 54696 182635167 1291185 2160263 38368530 15972.000 193364 glg 5 160 74282 74059 9251905 87916 120180 22622910 733.202 72148 620

An Improved Search Algorithm for Optimal Multiple-Sequence Alignment Table 10: Long sequences, high similarity. S δ g∗(t) h(s) Exp Op Op+Cl Heu Time Mem 1ad3 4 20 33641 33604 104627 2218 3461 34539 4.196 3968 1gpb 5 54 101296 101231 1232707 62184 98476 2702949 178.610 25698 1gtr 5 60 55242 55133 2037633 54496 91656 1916127 226.791 18050 1lcf 6 160 149249 148854 181810148 3235312 3824010 28614215 15363.051 294688 1rthA 5 128 69296 69133 14891538 71081 105082 24587882 1721.070 70569 1taq 5 250 133723 133321 1693501628 9384718 17298456 145223167 5713.240 1170673 3pmg 4 51 42193 42133 1036943 8511 15540 777639 50.796 8133 actin 5 53 48924 48826 824295 35283 53009 777058 96.147 11198 621

Schroedl References Altschul, S., Gish, W., Miller, W., Myers, E., & Lipman, D. (1990). Basic local alignment search tool. Journal of Molecular Biology, 215, 403–410. Altschul, S. F. (1989). Gap costs for multiple sequence alignment. Journal of Theoretical Biology, 138, 297–309. Carrillo, H., & Lipman, D. (1988). The multiple sequence alignment problem in biology. SIAM Journal of Applied Mathematics, 5 (48), 1073–1082. Chan, S. C., Wong, A. K. C., & Chiu, D. K. Y. (1992). A survey of multiple sequence comparison techniques. Bulletin of Mathematical Biology, 54 (4), 563–598. Culberson, J. C., & Schaeffer, J. (1998). Pattern databases. Computational Intelligence, 14 (4), 318–334. Davidson, A. (2001). A fast pruning algorithm for optimal sequence alignment. In Proceed- ings of The 2nd IEEE International Symposium on Bioinformatics and Bioengineering(BIBE’2001), pp. 49–56. Dayhoff, M. O., Schwartz, R. M., & Orcutt, B. C. (1978). A model of evolutionary change in proteins. In Dayhoff, M. O. (Ed.), Atlas of Protein Sequence and Structure, pp.345–352, Washington, D.C. National Biomedical Research Foundation. Dial, R. B. (1969). Shortest-path forest with topological ordering. Comm. ACM, 12 (11), 632–633. Dijkstra, E. W. (1959). A note on two problems in connection with graphs.. Numerische Mathematik, 1, 269–271. Gupta, S., Kececioglu, J., & Schaeffer, A. (1995). Improving the practical space and time efficiency of the shortest-paths approach to sum-of-pairs multiple sequence alignment.J. Computational Biology, 2 (3), 459–472. Gusfield, D. (1993). Efficient methods for multiple sequence alignment with guaranteed error bounds. Bull. of Math. Biol., 55 (1), 141–154. Hart, P. E., Nilsson, N. J., & Raphael, B. (1968). A formal basis for heuristic determination of minimum path cost. IEEE Trans. on Systems Science and Cybernetics, 4, 100–107. Hirschberg, D. S. (1975). A linear space algorithm for computing maximal common subse- quences. Comm. ACM, 6 (18), 341–343. Ikeda, T., & Imai, H. (1994). Fast A* algorithms for multiple sequence alignment. In Proceedings of the Genome Informatics Workshop, pp. 90–99. Jones, D. T., Taylor, W. R., & Thornton, J. M. (1992). The rapid generation of mutation data matrices from protein sequences. CABIOS, 3, 275–282. Kobayashi, H., & Imai, H. (1998). Improvement of the A* algorithm for multiple sequence alignment. In Miyano, S., & Takagi, T. (Eds.), Genome Informatics, pp. 120–130,Tokyo. Universal Academy Press. Korf, R. E. (1985). Depth-first iterative-deepening: An optimal admissible tree search. Artificial Intelligence, 27 (1), 97–109. 622

An Improved Search Algorithm for Optimal Multiple-Sequence Alignment Korf, R. E. (1999). Divide-and-conquer bidirectional search: First results. In Proceedings of the Sixteenth International Conference on Artificial Intelligence (IJCAI-99), pp.1181–1189, Stockholm, Sweden. Korf, R. E., & Zhang, W. (2000). Divide-and-conquer frontier search applied to optimal sequence alignment. In Proceedings of the Eighteenth National Conference on ArtificialIntelligence (AAAI-00), pp. 210–216. McNaughton, M., Lu, P., Schaeffer, J., & Szafron, D. (2002). Memory-efficient A* heuristics for multiple sequence alignment. In Proceedings of the Eighteenth National Conferenceon Artificial Intelligence (AAAI-02), Edmonton, Alberta, Canada. Spouge, J. L. (1989). Speeding up dynamic programming algorithms for finding optimal lattice paths. SIAM J. Applied Mathematics, 49 (5), 1552–1566. Thompson, J. D., Plewniak, F., & Poch, O. (1999). A comprehensive comparison of multiple sequence alignment programs. Nucleic Acids Res., 13 (27), 2682–2690. Ukkonen, E. (1985). Algorithms for approximate string matching. Information and Control, 64, 110–118. Wah, B. W., & Shang, Y. (1995). A comparison of a class of IDA* search algorithms. International Journal of Tools with Artificial Intelligence, 3 (4), 493–523. Wang, L., & Jiang, T. (1994). On the complexity of multiple sequence alignment. Journal of Computational Biology, 1, 337–348. Yoshizumi, T., Miura, T., & Ishida, T. (2000). A* with partial expansion for large branching factor problems. In AAAI/IAAI, pp. 923–929. Zhou, R., & Hansen, E. A. (2003a). Sparse-memory graph search. In 18th International Joint Conference on Artificial Intelligence (IJCAI-03), Acapulco, Mexico. Zhou, R., & Hansen, E. A. (2003b). Sweep A*: Space-efficient heuristic search in partially- ordered graphs. In 15th IEEE International Conference on Tools with Artificial In-telligence, Sacramento, CA. Zhou, R., & Hansen, E. A. (2004). Breadth-first heuristic search. In Fourteenth Interna- tional Conference on Automated Planning and Scheduling (ICAPS-04), Whistler, BC,Canada. 623